Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF7 Rabbit Polyclonal Antibody (FITC)

TCF7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TCF-1

UniProt

P36402

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TCF7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYHLLPRFPTELLTSPAER

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTPBP8 (NM_138485) Human Tagged ORF Clone Lentiviral Particle
RC219767L3V 200 µL

GTPBP8 (NM_138485) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human RECQL5 Nanobody
E55A12887 100 µg

Human RECQL5 Nanobody

Sign In for Pricing
View Details
Rabbit Monoclonal TLR12 Antibody (1229C) [Alexa Fluor 488]
FAB8086G 0.1 mL

Rabbit Monoclonal TLR12 Antibody (1229C) [Alexa Fluor 488]

Sign In for Pricing
View Details
Mouse Epithelial neutrophil activating peptide 78 ELISA Kit
MBS739681-01 48 Well

Mouse Epithelial neutrophil activating peptide 78 ELISA Kit

Sign In for Pricing
View Details
Mouse Epithelial neutrophil activating peptide 78 ELISA Kit
MBS739681-02 96 Well

Mouse Epithelial neutrophil activating peptide 78 ELISA Kit

Sign In for Pricing
View Details
Mouse Epithelial neutrophil activating peptide 78 ELISA Kit
MBS739681-03 5x 96 Well

Mouse Epithelial neutrophil activating peptide 78 ELISA Kit

Sign In for Pricing
View Details