Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEAD1 Rabbit Polyclonal Antibody (FITC)

TEAD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AA, REF1, TCF13, TEF-1, NTEF-1, TCF-13, TEAD-1

UniProt

P28347

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TEAD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIY

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068780

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMNN Protein (N-GST, Human)
P504258 100 µg

GMNN Protein (N-GST, Human)

Sign In for Pricing
View Details
Sheep Cell division cycle protein 20 homolog (CDC20) ELISA kit
GTR10461371 96 Well

Sheep Cell division cycle protein 20 homolog (CDC20) ELISA kit

Sign In for Pricing
View Details
RNU6-19 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
40439111 3x 1.0 µg

RNU6-19 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
P70 S6 Kinase Antibody
CST 9202L 300 µL

P70 S6 Kinase Antibody

Sign In for Pricing
View Details
ALDH3A1 siRNA (Mouse)
CRM0138-01 15 nmol

ALDH3A1 siRNA (Mouse)

Sign In for Pricing
View Details
ALDH3A1 siRNA (Mouse)
CRM0138-02 30 nmol

ALDH3A1 siRNA (Mouse)

Sign In for Pricing
View Details