Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2H2 Rabbit Polyclonal Antibody (FITC)

GTF2H2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P44, BTF2, TFIIH, BTF2P44, T-BTF2P44

UniProt

Q13888

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2H2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGC

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001506

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human COBL shRNA (UAS) - Lentiviral human COBL shRNA (UAS) (25)
GTR15349628 1 Vial

Lentiviral human COBL shRNA (UAS) - Lentiviral human COBL shRNA (UAS) (25)

Sign In for Pricing
View Details
Pterisolic acid C
TN4844 5 mg

Pterisolic acid C

Sign In for Pricing
View Details
Rat TPM2 (Tropomyosin 2 Beta) Microsample ELISA Kit
orb2997782-01 48 Tests

Rat TPM2 (Tropomyosin 2 Beta) Microsample ELISA Kit

Sign In for Pricing
View Details
Rat TPM2 (Tropomyosin 2 Beta) Microsample ELISA Kit
orb2997782-02 96 Tests

Rat TPM2 (Tropomyosin 2 Beta) Microsample ELISA Kit

Sign In for Pricing
View Details
LONP1 Rabbit Polyclonal Antibody (Cy5)
orb892139 100 µL

LONP1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
BRAND Transferpette S 100ul fixed vol
PIP5214 1 Each

BRAND Transferpette S 100ul fixed vol

Sign In for Pricing
View Details