Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAEP, Human (HEK293, His)

PAEP protein is a glycoprotein that regulates fertilization steps and exhibits immunomodulatory effects. PAEP Protein, Human (HEK293, His) is the recombinant human-derived PAEP protein, expressed by HEK293 , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

PAEP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/paep-protein-human-hek293-his.html

Purity

98.0

Smiles

MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

Molecular Formula

5047 (Gene_ID) P09466-1 (M19-F180) (Accession)

Molecular Weight

Approximately 24-28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal TLR4 Antibody (MTS510) [Alexa Fluor 594]
NBP2-24865AF594 0.1 mL

Rat Monoclonal TLR4 Antibody (MTS510) [Alexa Fluor 594]

Sign In for Pricing
View Details
Anti-DNMT3B Antibody Picoband®, Cy3 Conjugate
A00319-4-Cy3 100 µg/Vial

Anti-DNMT3B Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Sheep anti gliadin antibody ELISA kit
GTR10440094 96 Well

Sheep anti gliadin antibody ELISA kit

Sign In for Pricing
View Details
2-Bromo-4- (2-hydroxyethoxy) benzaldehyde
YLB19142-01 50 mg

2-Bromo-4- (2-hydroxyethoxy) benzaldehyde

Sign In for Pricing
View Details
2-Bromo-4- (2-hydroxyethoxy) benzaldehyde
YLB19142-02 0.5 g

2-Bromo-4- (2-hydroxyethoxy) benzaldehyde

Sign In for Pricing
View Details
Inhibitor hsa-miR-573 AAV miRNA Vector
Amh3103200 500 ng

Inhibitor hsa-miR-573 AAV miRNA Vector

Sign In for Pricing
View Details