Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEBPA Rabbit Polyclonal Antibody (Biotin)

CEBPA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CEBP, C/EBP-alpha

UniProt

P49715

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CEBPA

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGG

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_004355

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHMP2 (h) -PR
sc-60369-PR 10 µM - 20 µL

CHMP2 (h) -PR

Sign In for Pricing
View Details
Interleukin 27 Receptor Alpha (IL27RA/TCCR) Rabbit anti-Human Polyclonal (aa44-59) Antibody
GWB-5BC388 0.05 mg

Interleukin 27 Receptor Alpha (IL27RA/TCCR) Rabbit anti-Human Polyclonal (aa44-59) Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)
MBS2005836-01 0.1 mL

Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)
MBS2005836-02 0.2 mL

Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)
MBS2005836-03 0.5 mL

Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)
MBS2005836-04 1 mL

Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)

Sign In for Pricing
View Details