Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEBPA Rabbit Polyclonal Antibody (HRP)

CEBPA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CEBP, C/EBP-alpha

UniProt

P49715

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CEBPA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGG

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_004355

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP)
TRV-0016823-01 20 µL

Monoclonal Antibody to N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP)

Sign In for Pricing
View Details
Monoclonal Antibody to N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP)
TRV-0016823-02 100 µL

Monoclonal Antibody to N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP)

Sign In for Pricing
View Details
Monoclonal Antibody to N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP)
TRV-0016823-03 200 µL

Monoclonal Antibody to N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP)

Sign In for Pricing
View Details
Monoclonal Antibody to N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP)
TRV-0016823-04 1 mL

Monoclonal Antibody to N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP)

Sign In for Pricing
View Details
CUEDC2 Rabbit Polyclonal Antibody (PerCP)
orb2416256 100 µL

CUEDC2 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Rat tissue inhibitors of metalloproteinase 1,TIMP-1 ELISA Kit
CN-01463R2 48T

Rat tissue inhibitors of metalloproteinase 1,TIMP-1 ELISA Kit

Sign In for Pricing
View Details