Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JUN Rabbit Polyclonal Antibody (HRP)

JUN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AP1, p39, AP-1, cJUN, c-Jun

UniProt

P05412

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human JUN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP

Field of Research

Cancer Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

ChIP, IHC, WB

NCBI Accession Number

NP_002219

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antitumor agent-202
T206663-01 10 mg

Antitumor agent-202

Sign In for Pricing
View Details
Antitumor agent-202
T206663-02 50 mg

Antitumor agent-202

Sign In for Pricing
View Details
Mouse Monocyte Chemotactic Protein 3 (MCP3) Antibody Pair Kit (with Standard)
MBS2089699-01 5x 96 Tests

Mouse Monocyte Chemotactic Protein 3 (MCP3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Monocyte Chemotactic Protein 3 (MCP3) Antibody Pair Kit (with Standard)
MBS2089699-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Monocyte Chemotactic Protein 3 (MCP3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Monocyte Chemotactic Protein 3 (MCP3) Antibody Pair Kit (with Standard)
MBS2089699-03 10x 96 Tests

Mouse Monocyte Chemotactic Protein 3 (MCP3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Monocyte Chemotactic Protein 3 (MCP3) Antibody Pair Kit (with Standard)
MBS2089699-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Monocyte Chemotactic Protein 3 (MCP3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details