Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2F5 Rabbit Polyclonal Antibody (Biotin)

E2F5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

E2F-5

UniProt

Q15329

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human E2F5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001942

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Prolyl-4-Hydroxylase Alpha Polypeptide III ELISA Kit
MBS085198-01 48 Well

Camel Prolyl-4-Hydroxylase Alpha Polypeptide III ELISA Kit

Sign In for Pricing
View Details
Camel Prolyl-4-Hydroxylase Alpha Polypeptide III ELISA Kit
MBS085198-02 96 Well

Camel Prolyl-4-Hydroxylase Alpha Polypeptide III ELISA Kit

Sign In for Pricing
View Details
Camel Prolyl-4-Hydroxylase Alpha Polypeptide III ELISA Kit
MBS085198-03 5x 96 Well

Camel Prolyl-4-Hydroxylase Alpha Polypeptide III ELISA Kit

Sign In for Pricing
View Details
Camel Prolyl-4-Hydroxylase Alpha Polypeptide III ELISA Kit
MBS085198-04 10x 96 Well

Camel Prolyl-4-Hydroxylase Alpha Polypeptide III ELISA Kit

Sign In for Pricing
View Details
SERPING1 (Plasma Protease C1 Inhibitor, C1 Inh, C1Inh, C1 Esterase Inhibitor, C1-inhibiting Factor, Serpin G1, C1IN, C1NH)
139857 200 µL

SERPING1 (Plasma Protease C1 Inhibitor, C1 Inh, C1Inh, C1 Esterase Inhibitor, C1-inhibiting Factor, Serpin G1, C1IN, C1NH)

Sign In for Pricing
View Details
Anti-PLCD1 Antibody
A05094 100 µL

Anti-PLCD1 Antibody

Sign In for Pricing
View Details