Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EN1 Rabbit Polyclonal Antibody (HRP)

EN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ENDOVESLB

UniProt

Q05925

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human EN1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001417

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGKV1OR2-0 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV729698 1.0 µg DNA

IGKV1OR2-0 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Anti-MMP14 (LEM-2/15) (Mouse, Monoclonal, IgG1, kappa)
A128938 100 µL

Anti-MMP14 (LEM-2/15) (Mouse, Monoclonal, IgG1, kappa)

Sign In for Pricing
View Details
IFluor® 594 Anti-human CD98 Antibody *MEM-108*
109800C0-AAT 100 Tests

IFluor® 594 Anti-human CD98 Antibody *MEM-108*

Sign In for Pricing
View Details
EIF2A cDNA Clone
MBS1272276-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

EIF2A cDNA Clone

Sign In for Pricing
View Details
EIF2A cDNA Clone
MBS1272276-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

EIF2A cDNA Clone

Sign In for Pricing
View Details
YARS2 CRISPR Knock Out 293T Cell Line (Human)
50588141 1x 10^6 Cells / 1.0 mL

YARS2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details