Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXD10 Rabbit Polyclonal Antibody (FITC)

HOXD10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HOX4, HOX4D, HOX4E, Hox-4.4

UniProt

P28358

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HOXD10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSA

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002139

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFATc3 (phospho Ser165) Polyclonal Antibody
orb1097580-01 50 μL

NFATc3 (phospho Ser165) Polyclonal Antibody

Sign In for Pricing
View Details
NFATc3 (phospho Ser165) Polyclonal Antibody
orb1097580-02 100 µL

NFATc3 (phospho Ser165) Polyclonal Antibody

Sign In for Pricing
View Details
CCDC99 Antibody
E310263 200 µL

CCDC99 Antibody

Sign In for Pricing
View Details
Chicken ES ELISA Kit
ECKE0321 96 Tests

Chicken ES ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Ornithine Decarboxylase Antibody (rODC1/487) [DyLight 594]
NBP3-14027DL594 0.1 mL

Mouse Monoclonal Ornithine Decarboxylase Antibody (rODC1/487) [DyLight 594]

Sign In for Pricing
View Details
NRG4 (Pro-neuregulin-4, Membrane-bound Isoform, Pro-NRG4, DKFZp779N0541, DKFZp779N1944, HRG4) (PE)
MBS6387567-01 0.1 mL

NRG4 (Pro-neuregulin-4, Membrane-bound Isoform, Pro-NRG4, DKFZp779N0541, DKFZp779N1944, HRG4) (PE)

Sign In for Pricing
View Details