What is the catalog number for HOXD10 Rabbit Polyclonal Antibody (HRP)?

The catalog number for HOXD10 Rabbit Polyclonal Antibody (HRP) is orb2065718.

What sizes are available for HOXD10 Rabbit Polyclonal Antibody (HRP)?

HOXD10 Rabbit Polyclonal Antibody (HRP) is available in the following size(s): 100 µL.

Is HOXD10 Rabbit Polyclonal Antibody (HRP) in stock?

HOXD10 Rabbit Polyclonal Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

HOXD10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOX4, HOX4D, HOX4E, Hox-4.4

UniProt

P28358

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HOXD10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSA

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.