Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ID2 Rabbit Polyclonal Antibody (FITC)

ID2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GIG8, ID2A, ID2H, bHLHb26

UniProt

Q02363

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ID2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALC

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002157

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse 4930444G20Rik shRNA (UAS) - Lentiviral mouse 4930444G20Rik shRNA (UAS) (100)
GTR15214986 1 Vial

Lentiviral mouse 4930444G20Rik shRNA (UAS) - Lentiviral mouse 4930444G20Rik shRNA (UAS) (100)

Sign In for Pricing
View Details
Sheep Coiled-coil domain-containing protein 50 (CCDC50) ELISA Kit
MBS7206099-01 48 Well

Sheep Coiled-coil domain-containing protein 50 (CCDC50) ELISA Kit

Sign In for Pricing
View Details
Sheep Coiled-coil domain-containing protein 50 (CCDC50) ELISA Kit
MBS7206099-02 96 Well

Sheep Coiled-coil domain-containing protein 50 (CCDC50) ELISA Kit

Sign In for Pricing
View Details
Sheep Coiled-coil domain-containing protein 50 (CCDC50) ELISA Kit
MBS7206099-03 5x 96 Well

Sheep Coiled-coil domain-containing protein 50 (CCDC50) ELISA Kit

Sign In for Pricing
View Details
Sheep Coiled-coil domain-containing protein 50 (CCDC50) ELISA Kit
MBS7206099-04 10x 96 Well

Sheep Coiled-coil domain-containing protein 50 (CCDC50) ELISA Kit

Sign In for Pricing
View Details
Fmoc-Trp (Boc) Wang Resin
H0751501328.25G 25 g

Fmoc-Trp (Boc) Wang Resin

Sign In for Pricing
View Details