Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRF2 Rabbit Polyclonal Antibody (FITC)

IRF2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IRF-2

UniProt

P14316

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IRF2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002190

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEA10 Antibody
A47908-50UL 50 μL

MAGEA10 Antibody

Sign In for Pricing
View Details
CD27, CT (CD27, TNFRSF7, CD27 antigen, CD27L receptor, T-cell activation antigen CD27, T14, Tumor necrosis factor receptor superfamily member 7, CD27) (AP)
MBS6282971-01 0.2 mL

CD27, CT (CD27, TNFRSF7, CD27 antigen, CD27L receptor, T-cell activation antigen CD27, T14, Tumor necrosis factor receptor superfamily member 7, CD27) (AP)

Sign In for Pricing
View Details
CD27, CT (CD27, TNFRSF7, CD27 antigen, CD27L receptor, T-cell activation antigen CD27, T14, Tumor necrosis factor receptor superfamily member 7, CD27) (AP)
MBS6282971-02 5x 0.2 mL

CD27, CT (CD27, TNFRSF7, CD27 antigen, CD27L receptor, T-cell activation antigen CD27, T14, Tumor necrosis factor receptor superfamily member 7, CD27) (AP)

Sign In for Pricing
View Details
Porgaviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)
RA0825-01 100 µg

Porgaviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)

Sign In for Pricing
View Details
Porgaviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)
RA0825-02 1 mg

Porgaviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)

Sign In for Pricing
View Details
Porgaviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)
RA0825-03 5 mg

Porgaviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)

Sign In for Pricing
View Details