Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU5F1 Rabbit Polyclonal Antibody (Biotin)

POU5F1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OCT3, OCT4, OTF3, OTF4, OTF-3, Oct-3, Oct-4

UniProt

Q01860

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POU5F1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYT

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Goat, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_002692

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

STC2 (STC2, Stanniocalcin-2, Stanniocalcin-related protein) (MaxLight 490)
MBS6257704-01 0.1 mL

STC2 (STC2, Stanniocalcin-2, Stanniocalcin-related protein) (MaxLight 490)

Sign In for Pricing
View Details
STC2 (STC2, Stanniocalcin-2, Stanniocalcin-related protein) (MaxLight 490)
MBS6257704-02 5x 0.1 mL

STC2 (STC2, Stanniocalcin-2, Stanniocalcin-related protein) (MaxLight 490)

Sign In for Pricing
View Details
CORO1C AAV Vector (Mouse) (CMV)
16655104 1 µg

CORO1C AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
TNF-alpha APC1, Cachectin, Differentiation inducing factor (DIF), Macrophage cytotoxic factor (MCF), Necrosin, TNF alpha, TNF Macrophage Derived, TNF Monocyte Derived, TNF Superfamily Member 2, TNFA, TNFSF2, Tumor necrosis factor ligand Superfamily member
MBS6236565-01 0.1 mL

TNF-alpha APC1, Cachectin, Differentiation inducing factor (DIF), Macrophage cytotoxic factor (MCF), Necrosin, TNF alpha, TNF Macrophage Derived, TNF Monocyte Derived, TNF Superfamily Member 2, TNFA, TNFSF2, Tumor necrosis factor ligand Superfamily member

Sign In for Pricing
View Details
TNF-alpha APC1, Cachectin, Differentiation inducing factor (DIF), Macrophage cytotoxic factor (MCF), Necrosin, TNF alpha, TNF Macrophage Derived, TNF Monocyte Derived, TNF Superfamily Member 2, TNFA, TNFSF2, Tumor necrosis factor ligand Superfamily member
MBS6236565-02 5x 0.1 mL

TNF-alpha APC1, Cachectin, Differentiation inducing factor (DIF), Macrophage cytotoxic factor (MCF), Necrosin, TNF alpha, TNF Macrophage Derived, TNF Monocyte Derived, TNF Superfamily Member 2, TNFA, TNFSF2, Tumor necrosis factor ligand Superfamily member

Sign In for Pricing
View Details
Recombinant Human Alanine aminotransferase 1 (GPT)
orb1651300-01 20 µg

Recombinant Human Alanine aminotransferase 1 (GPT)

Sign In for Pricing
View Details