Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU5F1 Rabbit Polyclonal Antibody (FITC)

POU5F1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OCT3, OCT4, OTF3, OTF4, OTF-3, Oct-3, Oct-4

UniProt

Q01860

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POU5F1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYT

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Goat, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_002692

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Qsox1 ORF Vector (Mouse) (pORF)
ORF055374 1.0 µg DNA

Qsox1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
FCF1 Adenovirus (Rat)
20379056 1.0 mL

FCF1 Adenovirus (Rat)

Sign In for Pricing
View Details
FKRP (NM_001039885) Human Over-expression Lysate
LH04642V 100 µg

FKRP (NM_001039885) Human Over-expression Lysate

Sign In for Pricing
View Details
Biotinylated Human Siglec-2/CD22 Protein Recombinant
MBS553836-01 0.05 mg

Biotinylated Human Siglec-2/CD22 Protein Recombinant

Sign In for Pricing
View Details
Biotinylated Human Siglec-2/CD22 Protein Recombinant
MBS553836-02 0.25 mg

Biotinylated Human Siglec-2/CD22 Protein Recombinant

Sign In for Pricing
View Details
Biotinylated Human Siglec-2/CD22 Protein Recombinant
MBS553836-03 5x 0.25 mg

Biotinylated Human Siglec-2/CD22 Protein Recombinant

Sign In for Pricing
View Details