Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTX1 Rabbit Polyclonal Antibody (FITC)

OTX1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ38361, MGC15736

UniProt

P32242

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OTX1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSES

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055377

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GANAB Recombinant Rabbit Monoclonal Antibody [PSH01-53]
HA721696 100 µL

GANAB Recombinant Rabbit Monoclonal Antibody [PSH01-53]

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF568 conjugate, 0.1mg/mL
BNC681540-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PPP1R18 Antibody
KC-6141-01 50 μL

PPP1R18 Antibody

Sign In for Pricing
View Details
PPP1R18 Antibody
KC-6141-02 100 µL

PPP1R18 Antibody

Sign In for Pricing
View Details
PPP1R18 Antibody
KC-6141-03 1 mL

PPP1R18 Antibody

Sign In for Pricing
View Details
MLF2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H2]
TA504837BM 100 µL

MLF2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H2]

Sign In for Pricing
View Details