Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTX1 Rabbit Polyclonal Antibody (HRP)

OTX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ38361, MGC15736

UniProt

P32242

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OTX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSES

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055377

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLD sgRNA CRISPR Lentivector set (Human)
K0605901 3x 1.0 µg

DLD sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Cpm sgRNA CRISPR Lentivector (Rat) (Target 3)
K6046604 1.0 µg DNA

Cpm sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Asah1, Recombinant, Mouse, aa19-141, His-GST-Tag (Acid Ceramidase)
372347-01 20 µg

Asah1, Recombinant, Mouse, aa19-141, His-GST-Tag (Acid Ceramidase)

Sign In for Pricing
View Details
Asah1, Recombinant, Mouse, aa19-141, His-GST-Tag (Acid Ceramidase)
372347-02 100 µg

Asah1, Recombinant, Mouse, aa19-141, His-GST-Tag (Acid Ceramidase)

Sign In for Pricing
View Details
LETM1P1 Protein Vector (Human) (pPM-C-His)
PV090725 500 ng

LETM1P1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Novosphingobium aromaticivorans ATP synthase subunit beta (atpD)
MBS1427868-01 0.02 mg (E-Coli)

Recombinant Novosphingobium aromaticivorans ATP synthase subunit beta (atpD)

Sign In for Pricing
View Details