Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PC4 Rabbit Polyclonal Antibody (Biotin)

PC4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P15, PC4, p14

UniProt

P53999

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PC4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006704

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calreticulin (CRP55, Calregulin, Endoplasmic Reticulum Resident Protein 60, ERp60, HACBP, grp60, CRTC, CALR) (PE)
MBS6156854-01 0.1 mL

Calreticulin (CRP55, Calregulin, Endoplasmic Reticulum Resident Protein 60, ERp60, HACBP, grp60, CRTC, CALR) (PE)

Sign In for Pricing
View Details
Calreticulin (CRP55, Calregulin, Endoplasmic Reticulum Resident Protein 60, ERp60, HACBP, grp60, CRTC, CALR) (PE)
MBS6156854-02 5x 0.1 mL

Calreticulin (CRP55, Calregulin, Endoplasmic Reticulum Resident Protein 60, ERp60, HACBP, grp60, CRTC, CALR) (PE)

Sign In for Pricing
View Details
Rabbit Polyclonal LRRC19 Antibody [PE]
NBP2-97212PE 0.1 mL

Rabbit Polyclonal LRRC19 Antibody [PE]

Sign In for Pricing
View Details
Human FAK - Ready-To-Use ELISA Kit (Colorimetric)
NBP3-31678 1 Kit

Human FAK - Ready-To-Use ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
PKC Recombinant Antibody, PE-Cy5 Conjugated
bsm-62952R-PE-Cy5-01 20 µL

PKC Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
PKC Recombinant Antibody, PE-Cy5 Conjugated
bsm-62952R-PE-Cy5-02 100 µL

PKC Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details