Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAL1 Rabbit Polyclonal Antibody (HRP)

TAL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SCL, TCL5, tal-1, bHLHa17

UniProt

P17542

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TAL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: INFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVL

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_003180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRGPRX2 Antibody
A63259-50UG 50 µg

MRGPRX2 Antibody

Sign In for Pricing
View Details
Human SSR3 full length protein-synthetic nanodisc
E33F100468 10 µg

Human SSR3 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
1110021J02Rik Protein Vector (Mouse) (pPB-C-His)
PV146358 500 ng

1110021J02Rik Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Oligosaccharyl transferase subunit STT3 homolog (T12A2.2), partial
MBS1199789-01 1 mg (E-Coli)

Recombinant Caenorhabditis elegans Oligosaccharyl transferase subunit STT3 homolog (T12A2.2), partial

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Oligosaccharyl transferase subunit STT3 homolog (T12A2.2), partial
MBS1199789-02 1 mg (Yeast)

Recombinant Caenorhabditis elegans Oligosaccharyl transferase subunit STT3 homolog (T12A2.2), partial

Sign In for Pricing
View Details
Zfp410 Protein Vector (Mouse) (pPM-C-His)
PV249445 500 ng

Zfp410 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details