Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAL1 Rabbit Polyclonal Antibody (FITC)

TAL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SCL, TCL5, tal-1, bHLHa17

UniProt

P17542

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TAL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: INFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVL

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-6Rα Polyclonal Antibody
E041912 100 µg -100 µL

IL-6Rα Polyclonal Antibody

Sign In for Pricing
View Details
PIK3R2 (Y467) (PIK3R2, Phosphatidylinositol 3-kinase regulatory subunit beta, Phosphatidylinositol 3-kinase 85kD regulatory subunit beta) (PE) discontinued
040051-PE 200 µL

PIK3R2 (Y467) (PIK3R2, Phosphatidylinositol 3-kinase regulatory subunit beta, Phosphatidylinositol 3-kinase 85kD regulatory subunit beta) (PE) discontinued

Sign In for Pricing
View Details
Anti-Heat Shock Protein 27 (Hsp27) Polyclonal Antibody
CAU36504-01 100 µL

Anti-Heat Shock Protein 27 (Hsp27) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Heat Shock Protein 27 (Hsp27) Polyclonal Antibody
CAU36504-02 200 µL

Anti-Heat Shock Protein 27 (Hsp27) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Heat Shock Protein 27 (Hsp27) Polyclonal Antibody
CAU36504-03 1 mL

Anti-Heat Shock Protein 27 (Hsp27) Polyclonal Antibody

Sign In for Pricing
View Details
Tuba1c-set siRNA/shRNA/RNAi Lentivector (Mouse)
48793094 4x 500 ng

Tuba1c-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details