Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2B Rabbit Polyclonal Antibody (HRP)

GTF2B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TF2B, TFIIB

UniProt

Q00403

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIG

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001505

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNK1/2/3 Rabbit pAb
E45R30275N-50 50 µL

JNK1/2/3 Rabbit pAb

Sign In for Pricing
View Details
Tyrosine-protein kinase Tec Tec Rabbit Polyclonal Antibody (FITC)
orb2575905 100 µg

Tyrosine-protein kinase Tec Tec Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Complement Component 1, Q Subcomponent B (C1qB) Magnetic Fluorescence Assay Kit
MBS2159214-01 96 Tests

Complement Component 1, Q Subcomponent B (C1qB) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Complement Component 1, Q Subcomponent B (C1qB) Magnetic Fluorescence Assay Kit
MBS2159214-02 5x 96 Tests

Complement Component 1, Q Subcomponent B (C1qB) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Complement Component 1, Q Subcomponent B (C1qB) Magnetic Fluorescence Assay Kit
MBS2159214-03 10x 96 Tests

Complement Component 1, Q Subcomponent B (C1qB) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Bcl2, phosphorylated (S70) (BCL2, Apoptosis regulator Bcl-2) (MaxLight 550) discontinued
032465-ML550 100 µL

Bcl2, phosphorylated (S70) (BCL2, Apoptosis regulator Bcl-2) (MaxLight 550) discontinued

Sign In for Pricing
View Details