Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNH Rabbit Polyclonal Antibody (Biotin)

CCNH Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CAK, p34, p37, CycH

UniProt

P51946

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCNH

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001230

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Connexin 40 (CX40, Gap Junction alpha 5 Protein, CXA-5) (Mid) (MaxLight 650)
C7856-03A-ML650 100 µL

Connexin 40 (CX40, Gap Junction alpha 5 Protein, CXA-5) (Mid) (MaxLight 650)

Sign In for Pricing
View Details
Steroid sulfatase-IN-9
T206795-01 10 mg

Steroid sulfatase-IN-9

Sign In for Pricing
View Details
Steroid sulfatase-IN-9
T206795-02 50 mg

Steroid sulfatase-IN-9

Sign In for Pricing
View Details
4-Chloro-2-fluoro-5- (2-methoxyethoxy) phenylboronic acid, pinacol ester
431470-01 25 mg

4-Chloro-2-fluoro-5- (2-methoxyethoxy) phenylboronic acid, pinacol ester

Sign In for Pricing
View Details
4-Chloro-2-fluoro-5- (2-methoxyethoxy) phenylboronic acid, pinacol ester
431470-02 50 mg

4-Chloro-2-fluoro-5- (2-methoxyethoxy) phenylboronic acid, pinacol ester

Sign In for Pricing
View Details
AMPK, gamma3 (AMP Activated Protein Kinase gamma3, PRKAG3, protein kinase, AMP-activated, gamma 3 non-catalytic subunit, AMPKG3, 5'-AMP-activated protein kinase, gamma-3 Subunit, AMP-activated protein kinase, non-catalytic gamma-3 Subunit)
A1475-08F 100 µg

AMPK, gamma3 (AMP Activated Protein Kinase gamma3, PRKAG3, protein kinase, AMP-activated, gamma 3 non-catalytic subunit, AMPKG3, 5'-AMP-activated protein kinase, gamma-3 Subunit, AMP-activated protein kinase, non-catalytic gamma-3 Subunit)

Sign In for Pricing
View Details