Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MNAT1 Rabbit Polyclonal Antibody (Biotin)

MNAT1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MAT1, TFB3, CAP35, RNF66

UniProt

P51948

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MNAT1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGT

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002422

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2,4-Trinonyl Ester 1,2,4-Benzenetricarboxylic Acid-d57
TRC-T886292-5MG 5 mg

1,2,4-Trinonyl Ester 1,2,4-Benzenetricarboxylic Acid-d57

Sign In for Pricing
View Details
Anti-Proteasome beta 9 Rabbit Monoclonal Antibody
MA4747-.1 100 µL

Anti-Proteasome beta 9 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Acyl-protein thioesterase 2 (Lypla2)
MBS1340164-01 0.02 mg (E-Coli)

Recombinant Mouse Acyl-protein thioesterase 2 (Lypla2)

Sign In for Pricing
View Details
Recombinant Mouse Acyl-protein thioesterase 2 (Lypla2)
MBS1340164-02 0.1 mg (E-Coli)

Recombinant Mouse Acyl-protein thioesterase 2 (Lypla2)

Sign In for Pricing
View Details
Recombinant Mouse Acyl-protein thioesterase 2 (Lypla2)
MBS1340164-03 0.02 mg (Yeast)

Recombinant Mouse Acyl-protein thioesterase 2 (Lypla2)

Sign In for Pricing
View Details
Recombinant Mouse Acyl-protein thioesterase 2 (Lypla2)
MBS1340164-04 0.1 mg (Yeast)

Recombinant Mouse Acyl-protein thioesterase 2 (Lypla2)

Sign In for Pricing
View Details