Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MNAT1 Rabbit Polyclonal Antibody (HRP)

MNAT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MAT1, TFB3, CAP35, RNF66

UniProt

P51948

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MNAT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGT

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002422

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), Biotin conjugate, 0.1mg/mL
BNCB1553-500 1x 500 µL

MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMEM253 (NM_001146683) Human Over-expression Lysate
LC431176 20 µg

TMEM253 (NM_001146683) Human Over-expression Lysate

Sign In for Pricing
View Details
Capns1 Mouse Gene Knockout Kit (CRISPR)
KN502515 1 Kit

Capns1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTau205 Antibody
KC-29684-01 50 μL

PTau205 Antibody

Sign In for Pricing
View Details
PTau205 Antibody
KC-29684-02 100 µL

PTau205 Antibody

Sign In for Pricing
View Details
PTau205 Antibody
KC-29684-03 1 mL

PTau205 Antibody

Sign In for Pricing
View Details