Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK7 Rabbit Polyclonal Antibody (HRP)

CDK7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAK, CAK1, HCAK, MO15, STK1, CDKN7, p39MO15

UniProt

P50613

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CDK7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALE

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001790

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD17B4/MPF-2 Blocking Peptide
3617BP-50 50 μg

HSD17B4/MPF-2 Blocking Peptide

Sign In for Pricing
View Details
MLLT4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1308506 1.0 µg DNA

MLLT4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PARD6G sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1594408 1.0 µg DNA

PARD6G sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Vmn1r76 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3114106 1.0 µg DNA

Vmn1r76 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Elongin A1 Antibody
E18-9059-1 50 µg - 50 µL

Elongin A1 Antibody

Sign In for Pricing
View Details
Phospho-PLB (Thr17) Rabbit Polyclonal Antibody (BF647)
orb2393008 100 µL

Phospho-PLB (Thr17) Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details