Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK7 Rabbit Polyclonal Antibody (HRP)

CDK7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAK, CAK1, HCAK, MO15, STK1, CDKN7, p39MO15

UniProt

P50613

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CDK7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALE

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001790

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Unc5a (BC058084) Mouse Untagged Clone
MC220873 10 µg

Unc5a (BC058084) Mouse Untagged Clone

Sign In for Pricing
View Details
Lentiviral mouse Elf2 shRNA (UAS) - Lentiviral mouse Elf2 shRNA (UAS) plasmid
GTR15159619 1 Vial

Lentiviral mouse Elf2 shRNA (UAS) - Lentiviral mouse Elf2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
CTSH Antibody
A18511-50UG 50 µg

CTSH Antibody

Sign In for Pricing
View Details
Anti-R Cadherin Antibody (5U80)
TMAB-11975-01 25 µL

Anti-R Cadherin Antibody (5U80)

Sign In for Pricing
View Details
Anti-R Cadherin Antibody (5U80)
TMAB-11975-02 50 μL

Anti-R Cadherin Antibody (5U80)

Sign In for Pricing
View Details
Anti-R Cadherin Antibody (5U80)
TMAB-11975-03 100 µL

Anti-R Cadherin Antibody (5U80)

Sign In for Pricing
View Details