Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sialidase-1, Human (HEK293, His)

The Sialidase-1 protein plays a crucial role in cellular processes by catalyzing the removal of the sialic acid (N-acetylneuraminic acid) moiety from glycoproteins and glycolipids. Its enzymatic activity is strictly dependent on its presence in multienzyme complexes, emphasizing the cooperative nature of its function. Sialidase-1 Protein, Human (HEK293, His) is the recombinant human-derived Sialidase-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Sialidase-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sialidase-1-protein-human-hek-293-his.html

Purity

98.00

Smiles

ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

Molecular Formula

4758 (Gene_ID) Q99519 (E48-L415) (Accession)

Molecular Weight

Approximately 39-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromomethyl-6-nitrobenzoic Acid Methyl Ester
159462 250 mg

2-Bromomethyl-6-nitrobenzoic Acid Methyl Ester

Sign In for Pricing
View Details
CKR-6 CRISPR Activation Plasmid (h)
sc-403675-ACT 20 µg

CKR-6 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
RASGRF1 (NM_001145648) Human Tagged ORF Clone Lentiviral Particle
RC227574L3V 200 µL

RASGRF1 (NM_001145648) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
UNC5CL, ID (UNC5CL, ZUD, UNC5C-like protein, Protein unc-5 homolog C-like, ZU5 and death domain-containing protein)
MBS6009017-01 0.2 mL

UNC5CL, ID (UNC5CL, ZUD, UNC5C-like protein, Protein unc-5 homolog C-like, ZU5 and death domain-containing protein)

Sign In for Pricing
View Details
UNC5CL, ID (UNC5CL, ZUD, UNC5C-like protein, Protein unc-5 homolog C-like, ZU5 and death domain-containing protein)
MBS6009017-02 5x 0.2 mL

UNC5CL, ID (UNC5CL, ZUD, UNC5C-like protein, Protein unc-5 homolog C-like, ZU5 and death domain-containing protein)

Sign In for Pricing
View Details
ODR4 CRISPR Activation Plasmid (h)
sc-417633-ACT 20 µg

ODR4 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details