SKP2, Human (His-SUMO)
Product Specifications
UNSPSC Description
SKP2 serves as a substrate recognition component in the SCF E3 ubiquitin-protein ligase complex, directing ubiquitination and proteasomal degradation of key proteins in the cell cycle, signaling, and transcription. It crucially recognizes phosphorylated CDKN1B/p27kip and regulates the G1/S transition. SKP2 Protein, Human (His-SUMO) is the recombinant human-derived SKP2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of SKP2 Protein, Human (His-SUMO) is 424 a.a., with molecular weight of ~63.8 kDa.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/skp2-protein-human-his-sumo.html
Purity
90.00
Smiles
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL
Molecular Weight
Approximately 63.8 kDa
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -20°C for 2 years
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog