Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR4, Human (GST)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (GST) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CXCR4 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcr4-protein-human-gst.html

Smiles

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Molecular Formula

7852 (Gene_ID) P61073-2 (P303-S352) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEL1L (NM_005065) Human Tagged ORF Clone
RC221999 10 µg

SEL1L (NM_005065) Human Tagged ORF Clone

Sign In for Pricing
View Details
ATXN1L, ID (ATXN1L, BOAT, BOAT1, Ataxin-1-like, Brother of ataxin-1) (PE)
MBS6276809-01 0.2 mL

ATXN1L, ID (ATXN1L, BOAT, BOAT1, Ataxin-1-like, Brother of ataxin-1) (PE)

Sign In for Pricing
View Details
ATXN1L, ID (ATXN1L, BOAT, BOAT1, Ataxin-1-like, Brother of ataxin-1) (PE)
MBS6276809-02 5x 0.2 mL

ATXN1L, ID (ATXN1L, BOAT, BOAT1, Ataxin-1-like, Brother of ataxin-1) (PE)

Sign In for Pricing
View Details
Anti-Human CD357/TNFRSF18/GITR Antibody (hu6C8), PE
FHJ89822 100 Tests

Anti-Human CD357/TNFRSF18/GITR Antibody (hu6C8), PE

Sign In for Pricing
View Details
Rabbit Polyclonal PACS1 Antibody [CoraFluor 1]
NBP2-81695CL1 0.1 mL

Rabbit Polyclonal PACS1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Casein Kinase 2 beta Recombinant Rabbit mAb
BS46998-01 50 µL

Casein Kinase 2 beta Recombinant Rabbit mAb

Sign In for Pricing
View Details