Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR4, Human (GST)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (GST) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CXCR4 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcr4-protein-human-gst.html

Smiles

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Molecular Formula

7852 (Gene_ID) P61073-2 (P303-S352) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARFIP1 Knockout NCI-H1299 Polyclonal Cells
ARG30395 1 Million

ARFIP1 Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
Pclo 3'UTR Luciferase Stable Cell Line
TU116048 1.0 mL

Pclo 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PLEKHA1 Rabbit Monoclonal Antibody
AMRe02665-01 1 Each

PLEKHA1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PLEKHA1 Rabbit Monoclonal Antibody
AMRe02665-02 50 µL

PLEKHA1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PLEKHA1 Rabbit Monoclonal Antibody
AMRe02665-03 100 µL

PLEKHA1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CDV H/Hemagglutinin glycoprotein Protein, C-strep
EVV26101 100 μg

Recombinant CDV H/Hemagglutinin glycoprotein Protein, C-strep

Sign In for Pricing
View Details