Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR4, Human (GST)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (GST) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CXCR4 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcr4-protein-human-gst.html

Smiles

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Molecular Formula

7852 (Gene_ID) P61073-2 (P303-S352) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken ANAPC5/Anaphase-promoting complex subunit 5 ELISA Kit
MBS2904769-01 48 Well

Chicken ANAPC5/Anaphase-promoting complex subunit 5 ELISA Kit

Sign In for Pricing
View Details
Chicken ANAPC5/Anaphase-promoting complex subunit 5 ELISA Kit
MBS2904769-02 96 Well

Chicken ANAPC5/Anaphase-promoting complex subunit 5 ELISA Kit

Sign In for Pricing
View Details
Chicken ANAPC5/Anaphase-promoting complex subunit 5 ELISA Kit
MBS2904769-03 5x 96 Well

Chicken ANAPC5/Anaphase-promoting complex subunit 5 ELISA Kit

Sign In for Pricing
View Details
Chicken ANAPC5/Anaphase-promoting complex subunit 5 ELISA Kit
MBS2904769-04 10x 96 Well

Chicken ANAPC5/Anaphase-promoting complex subunit 5 ELISA Kit

Sign In for Pricing
View Details
MORC4 (NM_024657) Human Tagged ORF Clone
RC218749 10 µg

MORC4 (NM_024657) Human Tagged ORF Clone

Sign In for Pricing
View Details
NS8593 Hydrochloride
C11679-01 5 mg

NS8593 Hydrochloride

Sign In for Pricing
View Details