Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR4, Human (GST)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (GST) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CXCR4 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcr4-protein-human-gst.html

Smiles

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Molecular Formula

7852 (Gene_ID) P61073-2 (P303-S352) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-DNA PKcs (Ser2056) Recombinant Rabbit mAb
BS43275-01 50 µL

Phospho-DNA PKcs (Ser2056) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Phospho-DNA PKcs (Ser2056) Recombinant Rabbit mAb
BS43275-02 100 µL

Phospho-DNA PKcs (Ser2056) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Anti-NLK antibody
STJ24772 100 µl

Anti-NLK antibody

Sign In for Pricing
View Details
Recombinant Mouse NRIP1 Protein, His (Fc)-Avi-tagged
NRIP1-6202M 50 µg

Recombinant Mouse NRIP1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Alpha B Crystallin Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-61511R-PE-Cy5.5 100 µL

Alpha B Crystallin Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
GENLISA™ Diacylglycerol O-acyltransferase 2 (Rat DGAT2) ELISA
KLR3748 96 Well

GENLISA™ Diacylglycerol O-acyltransferase 2 (Rat DGAT2) ELISA

Sign In for Pricing
View Details