Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR4, Human (GST)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (GST) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CXCR4 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcr4-protein-human-gst.html

Smiles

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Molecular Formula

7852 (Gene_ID) P61073-2 (P303-S352) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Curvus alr Protein (aa 1-337)
VAng-Lsx5924-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Curvus alr Protein (aa 1-337)

Sign In for Pricing
View Details
MEI1 Double Nickase Plasmid (m2)
sc-428858-NIC-2 20 µg

MEI1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Rabbit anti-Cavia porcellus (Guinea pig) CD46 Polyclonal Antibody
MBS7138453 Inquire

Rabbit anti-Cavia porcellus (Guinea pig) CD46 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal KHSRP Antibody [Alexa Fluor 532]
NBP1-18911AF532 0.1 mL

Rabbit Polyclonal KHSRP Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
GKAP1 (NM_025211) Human Mass Spec Standard
PH304911 10 µg

GKAP1 (NM_025211) Human Mass Spec Standard

Sign In for Pricing
View Details
SRR (Biotin)
577830-01 50 µg

SRR (Biotin)

Sign In for Pricing
View Details