Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR4, Human (GST)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (GST) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CXCR4 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcr4-protein-human-gst.html

Smiles

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Molecular Formula

7852 (Gene_ID) P61073-2 (P303-S352) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human C5 Recombinant Antibody (Pozelimab)
YR1543-01 1 mg

Anti-Human C5 Recombinant Antibody (Pozelimab)

Sign In for Pricing
View Details
Anti-Human C5 Recombinant Antibody (Pozelimab)
YR1543-02 5 mg

Anti-Human C5 Recombinant Antibody (Pozelimab)

Sign In for Pricing
View Details
Pcdhgb1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4119206 1.0 µg DNA

Pcdhgb1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
BLK antibody
70R-32636 100 ug

BLK antibody

Sign In for Pricing
View Details
Low Sample Volume Mouse Neuropeptide Y (NPY) ELISA Kit
abx052318-01 96 Tests

Low Sample Volume Mouse Neuropeptide Y (NPY) ELISA Kit

Sign In for Pricing
View Details
Low Sample Volume Mouse Neuropeptide Y (NPY) ELISA Kit
abx052318-02 5x 96 Tests

Low Sample Volume Mouse Neuropeptide Y (NPY) ELISA Kit

Sign In for Pricing
View Details