Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR4, Human (GST)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (GST) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CXCR4 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcr4-protein-human-gst.html

Smiles

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Molecular Formula

7852 (Gene_ID) P61073-2 (P303-S352) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGAP21 sgRNA CRISPR Lentivector (Human) (Target 2)
K0116103 1.0 µg DNA

ARHGAP21 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Skp2 p45 shRNA (r) Lentiviral Particles
sc-270333-V 200 µL

Skp2 p45 shRNA (r) Lentiviral Particles

Sign In for Pricing
View Details
PIWIL2 Polyclonal Antibody
MBS8572734-01 0.1 mL

PIWIL2 Polyclonal Antibody

Sign In for Pricing
View Details
PIWIL2 Polyclonal Antibody
MBS8572734-02 0.1 mL (AF405L)

PIWIL2 Polyclonal Antibody

Sign In for Pricing
View Details
PIWIL2 Polyclonal Antibody
MBS8572734-03 0.1 mL (AF405S)

PIWIL2 Polyclonal Antibody

Sign In for Pricing
View Details
PIWIL2 Polyclonal Antibody
MBS8572734-04 0.1 mL (AF610)

PIWIL2 Polyclonal Antibody

Sign In for Pricing
View Details