Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR4, Human (GST)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (GST) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CXCR4 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcr4-protein-human-gst.html

Smiles

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Molecular Formula

7852 (Gene_ID) P61073-2 (P303-S352) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA14 Recombinant Protein Antigen
NBP2-14106PEP 0.1 mL

HSPA14 Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant Mouse SOX9 Protein, N-His
MBS1578638-01 0.1 mg

Recombinant Mouse SOX9 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse SOX9 Protein, N-His
MBS1578638-02 1 mg

Recombinant Mouse SOX9 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse SOX9 Protein, N-His
MBS1578638-03 5x 1 mg

Recombinant Mouse SOX9 Protein, N-His

Sign In for Pricing
View Details
Rat Erc1 ELISA Kit
ELI-39177r 96 Tests

Rat Erc1 ELISA Kit

Sign In for Pricing
View Details
SLC5A7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV652491 1.0 µg DNA

SLC5A7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details