Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR4, Human (GST)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (GST) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CXCR4 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcr4-protein-human-gst.html

Smiles

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Molecular Formula

7852 (Gene_ID) P61073-2 (P303-S352) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Histone H3/H3C1 Polyclonal Antibody
PAV7918 100 μL

Rabbit Anti-Histone H3/H3C1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC11A2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV690520 1.0 µg DNA

SLC11A2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
PCDHA8 (NM_018911) Human Untagged Clone
SC314978 10 µg

PCDHA8 (NM_018911) Human Untagged Clone

Sign In for Pricing
View Details
Porcine Scavenger receptor class B member 1,SCARB1 ELISA KIT
ELI-05042p 96 Tests

Porcine Scavenger receptor class B member 1,SCARB1 ELISA KIT

Sign In for Pricing
View Details
IP3KA (Inositol 1,4,5-trisphosphate 3-kinase A)
320516 100 µL

IP3KA (Inositol 1,4,5-trisphosphate 3-kinase A)

Sign In for Pricing
View Details
SNX29
334994-01 50 µL

SNX29

Sign In for Pricing
View Details