Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR4, Human (GST)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (GST) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CXCR4 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcr4-protein-human-gst.html

Smiles

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Molecular Formula

7852 (Gene_ID) P61073-2 (P303-S352) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tetraspanin 30Cluster of Differentiation 63 (CD63) ELISA Kit
EKU07609 96 Tests

Mouse Tetraspanin 30Cluster of Differentiation 63 (CD63) ELISA Kit

Sign In for Pricing
View Details
Human SCGN knockdown cell line
ABC-KD13409 1 Vial

Human SCGN knockdown cell line

Sign In for Pricing
View Details
Cat Suppressor of G2 Allele of SKP1 Homolog (SUGT1) ELISA Kit
MBS9354898 Inquire

Cat Suppressor of G2 Allele of SKP1 Homolog (SUGT1) ELISA Kit

Sign In for Pricing
View Details
BRCAA1 (ARID4B) (NM_031371) Human Over-expression Lysate
LY410549 100 µg

BRCAA1 (ARID4B) (NM_031371) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF965P Protein Vector (Human) (pPM-C-HA)
51922021 500 ng

ZNF965P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ABCB6 sgRNA CRISPR Lentivector set (Human)
K0018301 3x 1.0 µg

ABCB6 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details