Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR4, Human (GST)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (GST) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CXCR4 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcr4-protein-human-gst.html

Smiles

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Molecular Formula

7852 (Gene_ID) P61073-2 (P303-S352) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

JTB sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1112805 3x 1.0 µg

JTB sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RKIP Lentiviral Activation Particles (h)
sc-401270-LAC 200 µL

RKIP Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Acacetin 7-O- (6′′-O-α-L-rhamnopyranosyl-β-sophoroside)
MF-0064171-01 5 mg

Acacetin 7-O- (6′′-O-α-L-rhamnopyranosyl-β-sophoroside)

Sign In for Pricing
View Details
Acacetin 7-O- (6′′-O-α-L-rhamnopyranosyl-β-sophoroside)
MF-0064171-02 50 mg

Acacetin 7-O- (6′′-O-α-L-rhamnopyranosyl-β-sophoroside)

Sign In for Pricing
View Details
Goat anti-Human IgM Cross-Adsorbed Antibody DyLight 755 Conjugated
MBS3906938-01 0.5 mg

Goat anti-Human IgM Cross-Adsorbed Antibody DyLight 755 Conjugated

Sign In for Pricing
View Details
Goat anti-Human IgM Cross-Adsorbed Antibody DyLight 755 Conjugated
MBS3906938-02 5x 0.5 mg

Goat anti-Human IgM Cross-Adsorbed Antibody DyLight 755 Conjugated

Sign In for Pricing
View Details