Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR4, Human (GST)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (GST) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CXCR4 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcr4-protein-human-gst.html

Smiles

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Molecular Formula

7852 (Gene_ID) P61073-2 (P303-S352) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MAP3K7, N-His
MBS1572570-01 0.1 mg

Recombinant Human MAP3K7, N-His

Sign In for Pricing
View Details
Recombinant Human MAP3K7, N-His
MBS1572570-02 1 mg

Recombinant Human MAP3K7, N-His

Sign In for Pricing
View Details
Recombinant Human MAP3K7, N-His
MBS1572570-03 5x 1 mg

Recombinant Human MAP3K7, N-His

Sign In for Pricing
View Details
Rnf20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4060507 1.0 µg DNA

Rnf20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
ACOT2 Rabbit Polyclonal Antibody
E53P11356 100 µL

ACOT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACOT13 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-42157R-BF647 100 µL

ACOT13 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details