Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GITR, Human (T45A, HEK293, mFc)

GITR (TNFRSF18) is a member of the TNFR superfamily. GITR promotes T cell activation and proliferation and increases resistance to tumors and viral infections, and exacerbates autoimmune diseases and inflammation processes[1]. GITR Protein, Human (T45A, HEK293, mFc) is a recombinant protein with a C-terminal Fc label and T at position 45 is mutated to A. It consists of 136 amino acids (Q26-E161) and is produced in HEK293 cells.

Product Specifications

Product Name Alternative

GITR Protein, Human (T45A, HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gitr-protein-human-t45a-hek-293-mfc.html

Purity

95.0

Smiles

QRPTGGPGCGPGRLLLGTGADARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAE

Molecular Formula

8784 (Gene_ID) Q9Y5U5 (Q26-E161, T45A) (Accession)

Molecular Weight

40-55 kDa

References & Citations

[1]Tian J, et al. The Role of GITR/GITRL Interaction in Autoimmune Diseases. Front Immunol. 2020 Oct 9;11:588682.|[2]Krausz LT, et al. GITR-GITRL system, a novel player in shock and inflammation. ScientificWorldJournal. 2007 May 1;7:533-66.|[3]Shin HH, et al. Recombinant glucocorticoid induced tumor necrosis factor receptor (rGITR) induces NOS in murine macrophage. FEBS Lett. 2002 Mar 13;514 (2-3) :275-80.|[4]Liu Y, et al. Novel tumor suppressor function of glucocorticoid-induced TNF receptor GITR in multiple myeloma. PLoS One. 2013 Jun 13;8 (6) :e66982.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

15,16-Dehydroestrone
FD165478-01 1 Kg

15,16-Dehydroestrone

Sign In for Pricing
View Details
15,16-Dehydroestrone
FD165478-02 2 Kg

15,16-Dehydroestrone

Sign In for Pricing
View Details
(1-Acetylindolin-5-yl) boronic acid
OR1062196-01 100 mg

(1-Acetylindolin-5-yl) boronic acid

Sign In for Pricing
View Details
(1-Acetylindolin-5-yl) boronic acid
OR1062196-02 250 mg

(1-Acetylindolin-5-yl) boronic acid

Sign In for Pricing
View Details
GULP HDR Plasmid (m)
sc-427772-HDR 20 µg

GULP HDR Plasmid (m)

Sign In for Pricing
View Details
Anti-SGT1/ECD Antibody Picoband®
A00567-1 100 µg/Vial

Anti-SGT1/ECD Antibody Picoband®

Sign In for Pricing
View Details