Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2S, Human (GST)

The UBE2S protein is critical in cellular ubiquitination, accepting ubiquitin from the E1 complex and catalyzing covalent attachment to various proteins.UBE2S is a key contributor to cell cycle regulation, catalyzing "Lys-11"-linked polyubiquitination, which is critical for anaphase-promoting complex/cyclosome (APC/C) function.UBE2S Protein, Human (GST) is the recombinant human-derived UBE2S protein, expressed by E.coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UBE2S Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2s-protein-human-gst.html

Smiles

MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL

Molecular Formula

27338 (Gene_ID) Q16763 (M1-L222) (Accession)

Molecular Weight

Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SoNa™ 520 AM
21323-AAT 1 mg

SoNa™ 520 AM

Sign In for Pricing
View Details
MRPS9 Antibody
8C14045-AAT 50 µg

MRPS9 Antibody

Sign In for Pricing
View Details
PD-L1 (CD274) Mouse Monoclonal Antibody [Clone ID: OTI2C11]
CF812987 100 µg

PD-L1 (CD274) Mouse Monoclonal Antibody [Clone ID: OTI2C11]

Sign In for Pricing
View Details
Empagliflozin R/S-Furanose
TRC-E521560-1MG 1 mg

Empagliflozin R/S-Furanose

Sign In for Pricing
View Details
LLGL2 (C-term) Rabbit Polyclonal Antibody
AP12121PU-N 400 µL

LLGL2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nuarimol
TRC-N925320-25MG 25 mg

Nuarimol

Sign In for Pricing
View Details