Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2S, Human (GST)

The UBE2S protein is critical in cellular ubiquitination, accepting ubiquitin from the E1 complex and catalyzing covalent attachment to various proteins.UBE2S is a key contributor to cell cycle regulation, catalyzing "Lys-11"-linked polyubiquitination, which is critical for anaphase-promoting complex/cyclosome (APC/C) function.UBE2S Protein, Human (GST) is the recombinant human-derived UBE2S protein, expressed by E.coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UBE2S Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2s-protein-human-gst.html

Smiles

MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL

Molecular Formula

27338 (Gene_ID) Q16763 (M1-L222) (Accession)

Molecular Weight

Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAI1 (ADGRB1) Human Gene Knockout Kit (CRISPR)
KN424196 1 Kit

BAI1 (ADGRB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Protein Kinase C Zeta (PKCz) ELISA Kit
RD-PKCz-Hu-01 96 Tests

Human Protein Kinase C Zeta (PKCz) ELISA Kit

Sign In for Pricing
View Details
Human Protein Kinase C Zeta (PKCz) ELISA Kit
RD-PKCz-Hu-02 48 Tests

Human Protein Kinase C Zeta (PKCz) ELISA Kit

Sign In for Pricing
View Details
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF640R conjugate, 0.1mg/mL
BNC402224-500 1x 500 µL

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMC3 Rabbit Polyclonal Antibody
TA381772 100 µL

SMC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COL14A1 Human Gene Knockout Kit (CRISPR)
KN421279 1 Kit

COL14A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details