Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage K3 Holin (T), partial

Product Specifications

Product Name Alternative

(Lysis protein)

Abbreviation

Recombinant Enterobacteria phage K3 Holin protein, partial

Gene Name

T

UniProt

P10393

Expression Region

50-218aa

Organism

Enterobacteria phage K3 (Bacteriophage K3)

Target Sequence

RGDSFFEYYKQSKYETYSEIIEKERNARFESVALEQLQIVHISSEADFSAVYSFRPKNLNYFVDIIAYEGKLPSTISEKSLGGYPVDKTMDEYTVHLNGRHYYSNSKFAFLPTKKPTPEINYMYSCPYFNLDNIYAGTITMYWYRNDHISNDRLESICSQAARILGRAK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Exhibits a coumarin 7-hydroxylase activity. Active in the metabolic activation of hexamethylphosphoramide, N, N-dimethylaniline, 2'-methoxyacetophenone, N-nitrosomethylphenylamine, and the tobacco-specific carcinogen, 4- (methylnitrosamino) -1- (3-pyridyl) -1-butanone. Possesses phenacetin O-deethylation activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.2 kDa

References & Citations

"Single nucleotide polymorphisms of the human cyp2a13 gene: evidence for a null allele." Zhang X., Chen Y., Liu Y., Ren X., Zhang Q.Y., Caggana M., Ding X. Drug Metab Dispos 31:1081-1085 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Echovirus Antigen, Recombinant
REC31776-100 1 Each

Echovirus Antigen, Recombinant

Sign In for Pricing
View Details
Hepsin (HPN) (NM_182983) Human Tagged Lenti ORF Clone
RC221292L4 10 µg

Hepsin (HPN) (NM_182983) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZAP70 Rabbit Polyclonal Antibody (Cy3)
orb2617898 100 µg

ZAP70 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Mouse Plexin C1/PLXNC1 ELISA Kit
orb526821 96 Tests

Mouse Plexin C1/PLXNC1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Interleukin 5 (IL5)
RPU55473-01 50 µg

Recombinant Interleukin 5 (IL5)

Sign In for Pricing
View Details
Recombinant Interleukin 5 (IL5)
RPU55473-02 100 µg

Recombinant Interleukin 5 (IL5)

Sign In for Pricing
View Details