Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SDF-1 alpha/CXCL12, Human (His)

The SDF-1 alpha/CXCL12 protein is a chemoattractant for immune cells. Animal-Free SDF-1 Beta/CXCL12 Protein, Human (His) is the recombinant human-derived animal-FreeSDF-1 Beta/CXCL12 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SDF-1 alpha/CXCL12 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-sdf-1-beta-cxcl12-protein-human-his.html

Purity

98.0

Smiles

MVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN

Molecular Formula

6387 (Gene_ID) P48061-2 (V24-N88) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2AK2 Antibody, Biotin Conjugated
MBS7133874-01 0.05 mL

EIF2AK2 Antibody, Biotin Conjugated

Sign In for Pricing
View Details
EIF2AK2 Antibody, Biotin Conjugated
MBS7133874-02 0.1 mL

EIF2AK2 Antibody, Biotin Conjugated

Sign In for Pricing
View Details
EIF2AK2 Antibody, Biotin Conjugated
MBS7133874-03 5x 0.1 mL

EIF2AK2 Antibody, Biotin Conjugated

Sign In for Pricing
View Details
PTPN22 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1757005 3x 1.0 µg

PTPN22 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CDC42SE2 Mouse Monoclonal Antibody [Clone:1B2]
E45M18182 100 µg

CDC42SE2 Mouse Monoclonal Antibody [Clone:1B2]

Sign In for Pricing
View Details
COL9A2 Protein Vector (Human) (pPB-N-His)
PV070406 500 ng

COL9A2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details