Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF4L1 Rabbit Polyclonal Antibody (FITC)

DCAF4L1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

WDR21B

UniProt

Q3SXM0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human DCAF4L1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WSLHDARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001025126.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Anti-Tissue Factor (TF) Polyclonal Antibody
TRV-0020075-01 50 Tests

FITC-Linked Anti-Tissue Factor (TF) Polyclonal Antibody

Sign In for Pricing
View Details
FITC-Linked Anti-Tissue Factor (TF) Polyclonal Antibody
TRV-0020075-02 100 Tests

FITC-Linked Anti-Tissue Factor (TF) Polyclonal Antibody

Sign In for Pricing
View Details
FITC-Linked Anti-Tissue Factor (TF) Polyclonal Antibody
TRV-0020075-03 200 Tests

FITC-Linked Anti-Tissue Factor (TF) Polyclonal Antibody

Sign In for Pricing
View Details
SATB1 Protein Vector (Mouse) (pPB-N-His)
PV226727 500 ng

SATB1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Inositol 1,4,5-trisphosphate 3-kinase A, NT (Inositol-trisphosphate 3-kinase A, InsP 3-kinase A, IP3 3-kinase A, IP3K A, IP3KA, IP3-3KA, ITPKA) (Azide free) (HRP)
MBS6481768-01 0.2 mL

Inositol 1,4,5-trisphosphate 3-kinase A, NT (Inositol-trisphosphate 3-kinase A, InsP 3-kinase A, IP3 3-kinase A, IP3K A, IP3KA, IP3-3KA, ITPKA) (Azide free) (HRP)

Sign In for Pricing
View Details
Inositol 1,4,5-trisphosphate 3-kinase A, NT (Inositol-trisphosphate 3-kinase A, InsP 3-kinase A, IP3 3-kinase A, IP3K A, IP3KA, IP3-3KA, ITPKA) (Azide free) (HRP)
MBS6481768-02 5x 0.2 mL

Inositol 1,4,5-trisphosphate 3-kinase A, NT (Inositol-trisphosphate 3-kinase A, InsP 3-kinase A, IP3 3-kinase A, IP3K A, IP3KA, IP3-3KA, ITPKA) (Azide free) (HRP)

Sign In for Pricing
View Details