Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF17 Rabbit Polyclonal Antibody (HRP)

DCAF17 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C2orf37, C20orf37

UniProt

F5H7W1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DCAF17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IKITDMPPLLFEVSSLENAFQIGGHPWHYIVTPNKKKQKGVFHICALKDN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001158293

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MBL2, Tag Free
HA210628-01 20 µg

Human MBL2, Tag Free

Sign In for Pricing
View Details
Human MBL2, Tag Free
HA210628-02 50 µg

Human MBL2, Tag Free

Sign In for Pricing
View Details
Human MBL2, Tag Free
HA210628-03 100 µg

Human MBL2, Tag Free

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS809218 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Human HIDE1 (C19orf38) activation kit by CRISPRa
GA116838 1 Kit

Human HIDE1 (C19orf38) activation kit by CRISPRa

Sign In for Pricing
View Details
Human NXN activation kit by CRISPRa
GA112047 1 Kit

Human NXN activation kit by CRISPRa

Sign In for Pricing
View Details