Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5A Rabbit Polyclonal Antibody (HRP)

EIF5A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EIF-5A, EIF5A1, eIF-4D, eIF5AI

UniProt

P63241

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human EIF5A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza A Virus IgG Control Serum
C1231G 1 Each

Influenza A Virus IgG Control Serum

Sign In for Pricing
View Details
AZ 3146 5mg
A11170-5 5 mg

AZ 3146 5mg

Sign In for Pricing
View Details
Zona pellucida sperm-binding protein 4
MBS7043586-01 0.02 mg

Zona pellucida sperm-binding protein 4

Sign In for Pricing
View Details
Zona pellucida sperm-binding protein 4
MBS7043586-02 0.1 mg

Zona pellucida sperm-binding protein 4

Sign In for Pricing
View Details
Zona pellucida sperm-binding protein 4
MBS7043586-03 5x 0.1 mg

Zona pellucida sperm-binding protein 4

Sign In for Pricing
View Details
FAF1 Rabbit pAb
E45R30355N-50 50 µL

FAF1 Rabbit pAb

Sign In for Pricing
View Details