Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM177B Rabbit Polyclonal Antibody (Biotin)

FAM177B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

A6PVY3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM177B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LDLEKSVPSKKTTPKRIIHFVDGDIMEEYSTEEEEEEEKEEQSTNSTLDP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2E2 (NM_152653) Human Recombinant Protein
TP304787 20 µg

UBE2E2 (NM_152653) Human Recombinant Protein

Sign In for Pricing
View Details
NK1.1 / CD161c / Klrb1c, Mouse (PK136), 1mg/mL
BNUM2010-50 1x 50 µL

NK1.1 / CD161c / Klrb1c, Mouse (PK136), 1mg/mL

Sign In for Pricing
View Details
Human Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) ELISA Kit
RDR-DYRK1A-Hu-01 96 Tests

Human Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) ELISA Kit

Sign In for Pricing
View Details
Human Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) ELISA Kit
RDR-DYRK1A-Hu-02 48 Tests

Human Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) ELISA Kit

Sign In for Pricing
View Details
CK5P3 Polyclonal Antibody
D-AB-10307L-01 25 µL

CK5P3 Polyclonal Antibody

Sign In for Pricing
View Details
CK5P3 Polyclonal Antibody
D-AB-10307L-02 100 µL

CK5P3 Polyclonal Antibody

Sign In for Pricing
View Details