Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXL15 Rabbit Polyclonal Antibody (Biotin)

FBXL15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

JET, PSD, Fbl15, FBXO37

UniProt

Q9H469

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FBXL15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PPMEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_077302

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
MBS450426-01 48 Tests

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

Sign In for Pricing
View Details
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
MBS450426-02 96 Tests

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

Sign In for Pricing
View Details
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
MBS450426-03 5x 96 Tests

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

Sign In for Pricing
View Details
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
MBS450426-04 10x 96 Tests

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

Sign In for Pricing
View Details
CDC20 Recombinant Protein (Mouse)
RP122810 100 µg

CDC20 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Mouse Rundc1 Pre-designed siRNA Set A
SI112387A 1 Each

Mouse Rundc1 Pre-designed siRNA Set A

Sign In for Pricing
View Details