Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST1H4A Rabbit Polyclonal Antibody (HRP)

HIST1H4A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4FA, H4-16, H4C11, H4C12, H4C13, H4C14, H4C15, HIST1H4A

UniProt

P62805

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIST1H4A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_778224

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Phenyl-2-propen-1-one (Contains ~1% BHT as stabilizer)
TRC-P336260-5G 5 g

1-Phenyl-2-propen-1-one (Contains ~1% BHT as stabilizer)

Sign In for Pricing
View Details
CALM1 Mouse Monoclonal Antibody [Clone ID: J4D8]
AM03186PU-S 50 µL

CALM1 Mouse Monoclonal Antibody [Clone ID: J4D8]

Sign In for Pricing
View Details
ARPC1A Polyclonal Antibody
E-AB-90869-01 60 µL

ARPC1A Polyclonal Antibody

Sign In for Pricing
View Details
ARPC1A Polyclonal Antibody
E-AB-90869-02 120 µL

ARPC1A Polyclonal Antibody

Sign In for Pricing
View Details
ARPC1A Polyclonal Antibody
E-AB-90869-03 200 µL

ARPC1A Polyclonal Antibody

Sign In for Pricing
View Details
ATG4B (N-term) Rabbit Polyclonal Antibody
AP32206PU-N 400 µL

ATG4B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details