Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILDR2 Rabbit Polyclonal Antibody (HRP)

ILDR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C1orf32, dJ782G3.1

UniProt

Q71H61

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ILDR2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AHLPRLVSRTPGTAPKYDHSYLGSARERQARPEGASRGGSLETPSKRSAQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_955383.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pan troglodytes Zinc phosphodiesterase ELAC protein 2 (ELAC2), partial
MBS1344532 Inquire

Recombinant Pan troglodytes Zinc phosphodiesterase ELAC protein 2 (ELAC2), partial

Sign In for Pricing
View Details
GPR55 sgRNA CRISPR Lentivector set (Human)
K0892001 3x 1.0 µg

GPR55 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) (FITC)
134803-FITC 100 µL

TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) (FITC)

Sign In for Pricing
View Details
TPRA1 Human Pre-designed siRNA Set A
HY-RS14947 1 Set

TPRA1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Mouse Olfactory receptor 146 (Olfr146), partial
MBS7086931 Inquire

Recombinant Mouse Olfactory receptor 146 (Olfr146), partial

Sign In for Pricing
View Details
Recombinant Human VIP36-Like Protein/LMAN2L (C-6His)
AP76046-01 10 µg

Recombinant Human VIP36-Like Protein/LMAN2L (C-6His)

Sign In for Pricing
View Details