Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILDR2 Rabbit Polyclonal Antibody (HRP)

ILDR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C1orf32, dJ782G3.1

UniProt

Q71H61

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ILDR2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AHLPRLVSRTPGTAPKYDHSYLGSARERQARPEGASRGGSLETPSKRSAQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_955383.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAH siRNA (Human)
orb1864899-01 15 nmol

PAH siRNA (Human)

Sign In for Pricing
View Details
PAH siRNA (Human)
orb1864899-02 30 nmol

PAH siRNA (Human)

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. ATP synthase subunit c (atpE)
MBS7009270-01 0.02 mg

Recombinant Mycobacterium sp. ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. ATP synthase subunit c (atpE)
MBS7009270-02 0.1 mg

Recombinant Mycobacterium sp. ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. ATP synthase subunit c (atpE)
MBS7009270-03 5x 0.1 mg

Recombinant Mycobacterium sp. ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
Recombinant Human Proteasome Activator Subunit 1
7-05948 10 µg

Recombinant Human Proteasome Activator Subunit 1

Sign In for Pricing
View Details