Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLUH Rabbit Polyclonal Antibody (HRP)

CLUH Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CLU1

UniProt

O75153

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CLUH

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVFTDGDLGDSGKRKKGLEMDPIDCTPPEYILPGSRERPLCPLQPQNRDW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

146kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056044

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tlr12 qPCR Primer Pair
QM73354S 200 Tests

Mouse Tlr12 qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit anti-human Bardet-Biedl syndrome 4 protein polyclonal Antibody(BBS4)
MBS1495316-01 0.05 mL

Rabbit anti-human Bardet-Biedl syndrome 4 protein polyclonal Antibody(BBS4)

Sign In for Pricing
View Details
Rabbit anti-human Bardet-Biedl syndrome 4 protein polyclonal Antibody(BBS4)
MBS1495316-02 0.1 mL

Rabbit anti-human Bardet-Biedl syndrome 4 protein polyclonal Antibody(BBS4)

Sign In for Pricing
View Details
Rabbit anti-human Bardet-Biedl syndrome 4 protein polyclonal Antibody(BBS4)
MBS1495316-03 5x 0.1 mL

Rabbit anti-human Bardet-Biedl syndrome 4 protein polyclonal Antibody(BBS4)

Sign In for Pricing
View Details
Tin Protoporphyrin IX . dichloride
ALX-430-051-M005 5 mg

Tin Protoporphyrin IX . dichloride

Sign In for Pricing
View Details
Human Collagen Type V Alpha 2 (COL5α2) ELISA Kit
orb2811365-01 48 Tests

Human Collagen Type V Alpha 2 (COL5α2) ELISA Kit

Sign In for Pricing
View Details