Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LACTBL1 Rabbit Polyclonal Antibody (HRP)

LACTBL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A8MY62

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human LACTBL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TPWEFHAQRGYRVVRKDGDLDGYAATFSLVPPLRLGLVLLLAGPRPPGPD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Rotavirus IgG, RV IgG ELISA KIT
ED0054Hu-01 96 Well

Human Rotavirus IgG, RV IgG ELISA KIT

Sign In for Pricing
View Details
S100A1 Polyclonal Antibody, FITC Conjugated
A55661-050 50 µL

S100A1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Mouse Kelch Like ECH Associated Protein 1 (KEAP1) ELISA Kit
RDR-KEAP1-Mu-01 96 Tests

Mouse Kelch Like ECH Associated Protein 1 (KEAP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Kelch Like ECH Associated Protein 1 (KEAP1) ELISA Kit
RDR-KEAP1-Mu-02 48 Tests

Mouse Kelch Like ECH Associated Protein 1 (KEAP1) ELISA Kit

Sign In for Pricing
View Details
Rabbit D-Xylose ELISA Kit
MBS7245342-01 48 Well

Rabbit D-Xylose ELISA Kit

Sign In for Pricing
View Details
Rabbit D-Xylose ELISA Kit
MBS7245342-02 96 Well

Rabbit D-Xylose ELISA Kit

Sign In for Pricing
View Details