Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKPD1 Rabbit Polyclonal Antibody (Biotin)

NKPD1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

J3KNK3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NKPD1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AMARSGPALPSAAGVLLKPSEPTDARPLPAPAACGSFTAYSSDILTEDDV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_940880

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VGLL4 Antibody - middle region : FITC (ARP66983_P050-FITC)
ARP66983_P050-FITC 100 µL

VGLL4 Antibody - middle region : FITC (ARP66983_P050-FITC)

Sign In for Pricing
View Details
TR1 (Tomoregulin 1, TMEFF1, CT120.1, C9orf2, Transmembrane Protein With EGF-Like And Two Follistatin-Like Domains 1, Cancer/Testis Antigen Family 120, Member 1)
365426 200 µL

TR1 (Tomoregulin 1, TMEFF1, CT120.1, C9orf2, Transmembrane Protein With EGF-Like And Two Follistatin-Like Domains 1, Cancer/Testis Antigen Family 120, Member 1)

Sign In for Pricing
View Details
VPS4A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2617107 1.0 µg DNA

VPS4A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
RRP8 Rabbit Polyclonal Antibody (FITC)
orb2088150 100 µL

RRP8 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Anaphase Promoting Complex Subunit 11 (ANAPC11) Rabbit anti-Mouse Polyclonal (N-Terminus) Antibody
GWB-1836CE 0.05 mL

Anaphase Promoting Complex Subunit 11 (ANAPC11) Rabbit anti-Mouse Polyclonal (N-Terminus) Antibody

Sign In for Pricing
View Details
PSME1 (Proteasome Activator Complex Subunit 1, 11S Regulator Complex Subunit Alpha, REG-Alpha, Activator of Multicatalytic Protease Subunit 1, Interferon Gamma Up-Regulated I-5111 Protein, IGUP I-5111, Proteasome Activator 28 Subunit Alpha, PA28a, PA28alpha, PSME1, IFI511)
406955-01 50 µL

PSME1 (Proteasome Activator Complex Subunit 1, 11S Regulator Complex Subunit Alpha, REG-Alpha, Activator of Multicatalytic Protease Subunit 1, Interferon Gamma Up-Regulated I-5111 Protein, IGUP I-5111, Proteasome Activator 28 Subunit Alpha, PA28a, PA28alpha, PSME1, IFI511)

Sign In for Pricing
View Details