Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ODF3L2 Rabbit Polyclonal Antibody (HRP)

ODF3L2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C19orf19

UniProt

Q3SX64

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ODF3L2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_872383

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human KNSTRN shRNA (UAS) - Lentiviral human KNSTRN shRNA (UAS, RFP) (100)
GTR15143964 1 Vial

Lentiviral human KNSTRN shRNA (UAS) - Lentiviral human KNSTRN shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Human Glutathione S-transferase theta 1/GSTT1 Recombinant Protein
PROTP30711-100ug 100 µg

Human Glutathione S-transferase theta 1/GSTT1 Recombinant Protein

Sign In for Pricing
View Details
ZNF186 Rabbit Polyclonal Antibody (AP)
orb964207 100 µL

ZNF186 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
DAPK3 Knockout HEK293T Polyclonal Cells
ARG3685 1 Million

DAPK3 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Yeast SPP1 Rabbit Polyclonal Antibody (PE)
orb2572948 200 µL

Yeast SPP1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
SOCS6 (Suppressor of Cytokine Signaling 6, SOCS-6, Cytokine-inducible SH2 Protein 4, CIS-4, Suppressor of Cytokine Signaling 4, SOCS-4, CIS4, SOCS4) (MaxLight 750) discontinued
S1040-06F-ML750 100 µL

SOCS6 (Suppressor of Cytokine Signaling 6, SOCS-6, Cytokine-inducible SH2 Protein 4, CIS-4, Suppressor of Cytokine Signaling 4, SOCS-4, CIS4, SOCS4) (MaxLight 750) discontinued

Sign In for Pricing
View Details