Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2A42 Rabbit Polyclonal Antibody (HRP)

OR2A42 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NGT9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2A42

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005287

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Fruit fly Sarm Antibody, Dylight594 Conjugate
DZ41167-Dylight594 200 µL

Anti-Fruit fly Sarm Antibody, Dylight594 Conjugate

Sign In for Pricing
View Details
Human PTD (Pentosidine) ELISA Kit
EKF57699 96 Tests

Human PTD (Pentosidine) ELISA Kit

Sign In for Pricing
View Details
Cetrorelix diacetate 5mg
A22622-5 5 mg

Cetrorelix diacetate 5mg

Sign In for Pricing
View Details
Lentiviral mouse Dcdc2a shRNA (UAS) - Lentiviral mouse Dcdc2a shRNA (UAS, iRFP) (25)
GTR15105818 1 Vial

Lentiviral mouse Dcdc2a shRNA (UAS) - Lentiviral mouse Dcdc2a shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
PARP1, NT (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD(+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 550)
MBS6330853-01 0.1 mL

PARP1, NT (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD(+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 550)

Sign In for Pricing
View Details
PARP1, NT (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD(+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 550)
MBS6330853-02 5x 0.1 mL

PARP1, NT (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD(+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 550)

Sign In for Pricing
View Details