Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4F4 Rabbit Polyclonal Antibody (HRP)

OR4F4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR4F18, OLA-7501

UniProt

Q96R69

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4F4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRRLRKWDAHSSVKF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004195

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FTHL17/CT38 Rabbit Polyclonal Antibody (APC-Cy7)
orb2502253 100 µL

FTHL17/CT38 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Pex19 Rat shRNA Lentiviral Particle (Locus ID 289233)
TL705936V 500 µL Each

Pex19 Rat shRNA Lentiviral Particle (Locus ID 289233)

Sign In for Pricing
View Details
Bnip2 siRNA Oligos set (Rat)
13393176 3x 5 nmol

Bnip2 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
LMNB1 3'UTR Luciferase Stable Cell Line
TU012530 1.0 mL

LMNB1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SyntabuLin (SYBU) (NM_001099745) Human Tagged Lenti ORF Clone
RC217946L3 10 µg

SyntabuLin (SYBU) (NM_001099745) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Progesterone Receptor Membrane Component 2 (PGRMC2) Antibody
abx008337-01 30 µL

Progesterone Receptor Membrane Component 2 (PGRMC2) Antibody

Sign In for Pricing
View Details