Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5P3 Rabbit Polyclonal Antibody (HRP)

OR5P3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JCG1

UniProt

Q8WZ94

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5P3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILITILKMHSTKGRHKAFSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_703146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Staphylococcus aureus Malonyl CoA-acyl carrier protein transacylase polyclonal Antibody(fabD), HRP conjugated
MBS1499968-01 0.05 mg

Rabbit anti-Staphylococcus aureus Malonyl CoA-acyl carrier protein transacylase polyclonal Antibody(fabD), HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Staphylococcus aureus Malonyl CoA-acyl carrier protein transacylase polyclonal Antibody(fabD), HRP conjugated
MBS1499968-02 0.1 mg

Rabbit anti-Staphylococcus aureus Malonyl CoA-acyl carrier protein transacylase polyclonal Antibody(fabD), HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Staphylococcus aureus Malonyl CoA-acyl carrier protein transacylase polyclonal Antibody(fabD), HRP conjugated
MBS1499968-03 5x 0.1 mg

Rabbit anti-Staphylococcus aureus Malonyl CoA-acyl carrier protein transacylase polyclonal Antibody(fabD), HRP conjugated

Sign In for Pricing
View Details
FUT2 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb921345 100 µL

FUT2 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
SOD2 Rabbit Polyclonal Antibody (PerCP-Cy7)
orb1607268 100 µL

SOD2 Rabbit Polyclonal Antibody (PerCP-Cy7)

Sign In for Pricing
View Details
Mouse Monoclonal CD63 Antibody (NKI/C3) [Alexa Fluor 488]
NBP2-34694AF488 0.1 mL

Mouse Monoclonal CD63 Antibody (NKI/C3) [Alexa Fluor 488]

Sign In for Pricing
View Details